Find the real protein target(s) of a peptide from its sequence — peptide target deorphanization / off-target identification, for ANY target class (GPCR, ion channel, protease, cytokine/growth-factor receptor, enzyme, integrin), not only GPCRs. Use when a peptide has a phenotype but does not bind its hypothesized target, when a peptide binds a target in one species or assay but not another, or to screen candidate targets for an orphan peptide. A target-class router steers a multi-route keyless pipeline (PROSITE/ELM motif, BLAST homology, HGNC/InterPro/GPCRdb/GtoPdb target-family enumeration, OpenTargets phenotype anchor, EnsemblCompara/Alliance cross-species reconciliation) plus optional NVIDIA-NIM co-folding (Boltz2, AlphaFold2-Multimer, OpenFold3) for structural confirmation.
72
87%
Does it follow best practices?
Run evals on this skill
Adds up to 20 points to the overall score
View guide
Low
Low-risk findings worth noting
Deorphanize a peptide: given a peptide sequence plus an observed phenotype (and often a hypothesized target the peptide does NOT actually bind), find its likely real protein target(s) — using ToolUniverse's keyless characterization, homology, target-family, phenotype, cross-species, and (optional, key-gated) co-folding tools.
The target can be anything, not just a GPCR. A target-class router (GPCR ligand / ion-channel toxin / protease target / cytokine or growth-factor receptor / integrin ligand / antimicrobial / unknown) classifies the peptide up front and adapts the enumeration strategy. GPCRs are the best-trodden case (and the validated control), but the pipeline's spine — homology, motif, phenotype, cross-species, co-fold — is target-class-agnostic, and family enumeration uses HGNC gene-family (general) + InterPro (general) + GPCRdb (GPCR-only cross-check).
The failure mode this skill defends against is guessing a target from the peptide's name or its assumed mechanism. A peptide can be phenotypically active yet not bind the hypothesized target — because it hits a paralog, a different family member, or the same receptor in a different species whose binding interface has diverged. So:
This skill is built on validated, mostly keyless tools (BLAST, ELM/PROSITE, GPCRdb/HGNC/GtoPdb, OpenTargets, EnsemblCompara/Alliance). The single key-gated step is the optional structural confirmation by co-folding (NVIDIA NIM), used only to rank an already-narrowed shortlist.
Two runnable scripts in scripts/ execute the whole pipeline so you don't have to chain the phase calls by hand. Both load ToolUniverse via the SDK and run from the repo root.
deorphanize_peptide.py — keyless candidate generation + ranking (Phases 1–4)No API key. For each peptide it characterizes it (PepCalc/ProtParam), flags non-canonical/cyclic residues, scans PROSITE + ELM signatures, flags protease/degradation liability, classifies the target class (GPCR / channel / protease / cytokine-receptor / integrin / …) and enumerates the candidate target family accordingly, anchors on phenotype (OpenTargets), and — for the top candidates — resolves the ortholog protein sequences and aligns the binding interface across human / assay-species / source-species (the mechanistic "binds in A, not B" step) and suggests a ClusPro-ready PDB structure. Prints a ranked candidate shortlist with evidence tiers.
python3 scripts/deorphanize_peptide.py \
--sequence <PEPTIDE_SEQ> \ # OR --fasta peptides.fasta for BATCH mode
--hypothesized-target <GENE> \ # optional; seeds family enumeration (e.g. GLP1R). OMIT for SEEDLESS mode
--phenotype "<disease name>" \ # optional, REPEATABLE; OpenTargets anchor (use the DISEASE node, not a symptom) — pass several to union plausible phenotypes
--assay-species mus_musculus \ # species of the NEGATIVE binding assay
--source-species <organism> \ # optional; species where binding WAS observed -> 3-way interface alignment
[--no-blast] [--out result.json]Modes:
--hypothesized-target GLP1R) — enumerate that gene's family as the candidate panel (cleanest). Even seeded, the sequence-derived candidates (below) are always unioned in, so a wrong hypothesized seed cannot blind the search to the real target's family — exactly the deorphanization premise.receptor/channel/protease, chosen by the router) via UniProt; degrades to phenotype-only if that resolver is transiently down. No longer receptor-only.--phenotype is repeatable; pass every plausible disease and the anchor is the union (max score per target). Best when you don't know the single right phenotype.--fasta) — one record per FASTA entry, sharing --phenotype/--assay-species.Extra signals it always reports:
A@P2) is DPP4-LABILE; exendin-4 (G@P2) is resistant. A labile flag triggers a "re-test with a DPP4 inhibitor or protease-resistant analog" note — a key alternative explanation for "works in vitro, not in the mouse assay."Norine_get_peptide and pass --cyclic to cofold_screen.py.EBI_msa_align), reporting per-pair % identity and substitution count. A low human-vs-assay identity flags the ortholog whose binding interface most plausibly diverged — the mechanistic answer to "binds in A, not B". If the source organism is a protist absent from UniProt, it reports insufficient and tells you to supply the partner sequence by hand.PDBeSIFTS_get_best_structures resolves a representative solved PDB id you can feed straight to ClusPro_submit_peptide_docking.Validated on the control (--sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS --hypothesized-target GLP1R --phenotype "type 2 diabetes mellitus"): recovers the class-B panel {GCGR, GHRHR, GIPR, GLP1R, GLP2R, SCTR}, flags GLP1R as hypothesized (tested negative), and promotes GIPR to Tier 1 (family + phenotype, score 0.674) as the leading real-target hypothesis — exactly the deorphanization re-ranking, produced with zero API keys.
cofold_screen.py — structural confirmation (Phase 5, key-gated)Co-folds the peptide against each shortlisted receptor and ranks by interface confidence (ipTM). Requires NVIDIA_API_KEY; without it, runs a DRY RUN that still resolves every receptor sequence (GPCRdb → UniProt fallback) and prints the co-fold plan, so you can verify inputs before paying for GPU time.
python3 scripts/cofold_screen.py --peptide <SEQ> --candidates GIPR GCGR GLP2R \
[--backend boltz2|alphafold2_multimer|openfold3] [--assay-species mus_musculus] [--out cofold.json]Use the scripts for the fast path. When you need to run, debug, or extend a single step by hand, the full per-phase manual reference — every tool call the scripts automate, with exact parameter names, gotchas, fallback chains, runtime notes, and two fully worked examples — lives in references/phases.md. Read it when a script step fails, when you want to drive a phase manually, or when you extend the pipeline to a new tool.
Six phases; the scripts automate 1–4 (and the Phase-5 dry run). Full detail + exact tool calls + gotchas are in references/phases.md — read it before driving any phase by hand.
| Phase | What it does | Key tools |
|---|---|---|
| 0 Verify | Confirm every tool loads; substitute fallbacks | tooluniverse.cli run … |
| 1 Characterize + motif + classify | Properties, non-canonical/cyclic flag, PROSITE/ELM signature → ligand family, target-class router (GPCR/channel/protease/cytokine/integrin/…) | PepCalc/ProtParam, ScanProsite→PROSITE_get_entry, ELM_*, ESMFold |
| 2 Candidate generation | 4 independent routes — homology, motif→domain, target-family enumeration (class-aware), phenotype anchor → union | BLAST/EBI_msa_align, HGNC+InterPro+GPCRdb+GtoPdb, OpenTargets |
| 3 Cross-species | Resolve "binds in A not B": align the ortholog interface across human / assay / source species | EnsemblCompara, Alliance, UniProt, EBI_msa_align |
| 4 Narrow + rank | Score on sequence × phenotype × pharmacology × cross-species → shortlist ≤15 | (intersection logic) |
| 5 Structural confirm (optional, key-gated) | Co-fold top candidates, rank by interface ipTM; or academic-free ClusPro docking | NvidiaNIM_boltz2/…, ClusPro_submit_peptide_docking |
| 6 Report | Ranked shortlist with evidence tiers + wet-lab plan | (inline report) |
Core intersection rule: the real target is where phenotype-plausible (Route 2D) meets sequence/structure-plausible (Routes 2A–2C). A name-level guess ("it's a GLP-1 analog so it's GLP1R") is exactly what produces off-target errors — never assert a target the union of routes didn't surface.
ortholog_one2one? interface % identity in the assay species?).Evidence tiers — always state which evidence is keyless/validated vs key-gated (co-fold not run), and flag any candidate that is a negative against the originally hypothesized target so the reader sees the re-ranking:
Validated on the exendin-4 → GLP1R control: recovers the class-B panel {GCGR, GHRHR, GIPR, GLP1R, GLP2R, SCTR}, flags GLP1R as the (negative) hypothesized target, and promotes GIPR to Tier 1 — the deorphanization re-ranking, produced with zero API keys. The full step-by-step (control and the real "binds in the source organism, not in mouse" case) is in references/phases.md.
Reproducible test prompts + checkable assertions are in evals/evals.json (the exendin-4 control, the source-organism/mouse-negative case, and a non-GPCR seedless case). To check the skill still behaves, run a prompt through it and verify the output against that eval's assertions.
1b02920
Also appears in
since Jul 28, 2026
If you maintain this skill, you can claim it as your own. Once claimed, you can manage eval scenarios, bundle related skills, attach documentation or rules, and ensure cross-agent compatibility.